PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc04g005610.2.1
Common NameLOC101248665
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 276aa    MW: 31877.2 Da    PI: 8.6743
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc04g005610.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.91.9e-53101351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL++++++k+++  ++i+evd+yk++Pw+Lp+k++ +ekewyfF++rd+ky++g r+nra+ sgyWkatg+dk 
  Solyc04g005610.2.1  10 LPPGFRFHPTDEELIMYYLRNQATSKPCPS-SIIPEVDVYKFDPWELPEKTEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKATGTDKG 99 
                         79**************************99.89***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
  Solyc04g005610.2.1 100 IYS-GTKYVGIKKALVFYKGKPPKGIKTDWIMHEYRL 135
                         ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.01E-647162IPR003441NAC domain
PROSITE profilePS5100561.04310162IPR003441NAC domain
PfamPF023651.2E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MVGKNNSNHL PPGFRFHPTD EELIMYYLRN QATSKPCPSS IIPEVDVYKF DPWELPEKTE  60
FGEKEWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKGI YSGTKYVGIK KALVFYKGKP  120
PKGIKTDWIM HEYRLSESRT QPTRPNGSMR LDDWVLCRIY KKKNLERAIE MMKVEEDTQE  180
PQIMSVTNPI HEVVASNGQQ TLKLPRTCSL SHLLEMDYFG SISQLFDDNN SYNTISQNNT  240
LMTNVNGYVM PHQAMEKFQL GEVSQISMNP SYQFQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-721016417167NO APICAL MERISTEM PROTEIN
1ut4_B3e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_A3e-721016417167NO APICAL MERISTEM PROTEIN
1ut7_B3e-721016417167NO APICAL MERISTEM PROTEIN
3swm_A3e-721016420170NAC domain-containing protein 19
3swm_B3e-721016420170NAC domain-containing protein 19
3swm_C3e-721016420170NAC domain-containing protein 19
3swm_D3e-721016420170NAC domain-containing protein 19
3swp_A3e-721016420170NAC domain-containing protein 19
3swp_B3e-721016420170NAC domain-containing protein 19
3swp_C3e-721016420170NAC domain-containing protein 19
3swp_D3e-721016420170NAC domain-containing protein 19
4dul_A3e-721016417167NAC domain-containing protein 19
4dul_B3e-721016417167NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.20840.0callus| flower| fruit| leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU4686390.0S.lycopersicum DNA sequence from clone SL_MboI-101P13 on chromosome 4, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004237044.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-112NAC29_ARATH; NAC transcription factor 29
TrEMBLK4BNG70.0K4BNG7_SOLLC; Uncharacterized protein
STRINGSolyc04g005610.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-113NAC-like, activated by AP3/PI
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]